PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G329600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bHLH
Protein Properties Length: 329aa    MW: 37221.6 Da    PI: 5.1898
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G329600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH31.23.9e-10146176131
                         CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC. CS
                 HLH   1 rrrahnerErrRRdriNsafeeLrellPkas 31 
                         +r++h ++Er+RR+++N+ ++ Lr+l+P ++
  Prupe.6G329600.2.p 146 QRMTHIAVERNRRKQMNEYLSVLRSLMPDSY 176
                         79**************************963 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474597.85E-9144181IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000832.04E-8144182No hitNo description
Gene3DG3DSA:4.10.280.103.4E-8144178IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.01145197IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.1E-7146175IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MALDAVVFPQ DPFSCATNKD LYSYWSSFDD DHHNFGFDND QDHHDQLQHQ ASLDFLGYQT  60
DHNPPNYGTN YYSSAPLNSM VPHFNELQLS NPNPDVSDTT SPTDDQPEFH QLPLDQTITM  120
ADSMPSTRAK RRRAKSRKNK EEIENQRMTH IAVERNRRKQ MNEYLSVLRS LMPDSYVQRE  180
LEQEVHFLGT QKPNNGVPFS QFFTFPQYST RSSGDHESAA AAMAELPLME CKLSNIAADI  240
EVTMVESHAS LKVRAKRIPK QLLKIVSGLH GMHLTILHLN VVTADDIVLY SLSLKVEDEC  300
TLASVDEIAT AVHQMLATIQ EEAMLNLN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146157RMTHIAVERNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061271e-33AP006127.1 Lotus japonicus genomic DNA, chromosome 5, clone: LjT48O21, TM0211, complete sequence.
GenBankFJ3797691e-33FJ379769.1 Lotus japonicus putative basic helix-loop-helix protein BHLH26 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008246511.10.0PREDICTED: transcription factor bHLH96-like
TrEMBLD9ZIP71e-166D9ZIP7_MALDO; BHLH domain class transcription factor
STRINGGLYMA20G37550.11e-101(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72210.17e-54bHLH family protein